| 1. |
 Hangers And Clips
JMTACC is a manufacturer & exporter of hanger, hook, plastic size tag, clip, collar support
"JMTACC" registered trademark garments accessories are ... |
 |
|
JMTACC Garments Accessories Co., Ltd.
[China] |
| Offer Type: sell |
Category: Consumer Goods and Appliances > Household Items and Cleaning Supplies
|
 |
| 2. |
sell Life buoy
Code: SF5555
Item Name: Life buoy
Features:
a) Emits smoke to catch attention
b) Used as an individual life saving device by seamen ...
|
 |
|
sunfine marine
[China] |
| Offer Type: sell |
Category: Marine > Marine Industrial Supplies
|
|
|
| 3. |
sell Immersion Suit
Code: SFB-2
Item Name: INSULATED IMMERSION AND THERMAL PROTECTIVE SUIT
Product Inspection Standard: Requirements of 1996 Amendments to SOLA ...
|
 |
|
sunfine marine
[China] |
| Offer Type: sell |
Category: Marine > Marine Industrial Supplies
|
|
|
| 4. |
Household Utensil
JMTACC is a manufacturer & exporter of bottle opener, key rings, cup & mug, photo frame, move picture, table gifts, cap, umbrella, mobile tape, lighte ... |
 |
|
JMTACC Garments Accessories Co., Ltd.
[China] |
| Offer Type: sell |
Category: Consumer Goods and Appliances > Household Items and Cleaning Supplies
|
|
|
| 5. |
 Konica used copiers for sale
1312----------------------35 units
7013----------------------10 units
7015----------------------03 units
7020----------------------58 units
|  |
|
GM Technology
[Spain] |
| Offer Type: sell |
Category: Office Supplies and Equipment > Office Equipment - Used
|
|
|
| 6. |
Minolta used copiers for sale
CF 2001------------------6 units
CF 2002----------------36 units
CF 9001----------------34 units
CF 910-------------------2 units
Di 151-- ... |
|
|
GM Technology
[Spain] |
| Offer Type: sell |
Category: Office Supplies and Equipment > Office Equipment - Used
|
|
|
| 7. |
Ricoh used copiers for sale
RICOH Aficio 1013-------------------67 units
RICOH Aficio 1013F------------------20 units
RICOH Aficio 1113--------------------37 units
RICOH ... |
|
|
GM Technology
[Spain] |
| Offer Type: sell |
Category: Office Supplies and Equipment > Office Equipment - Used
|
|
|
| 8. |
Used copiers for sale
Looking for good used copiers?Let me introduce to you the world leading company in the field of used copy machines: GM Technology (branch of TL Cop ... |
|
|
GM Technology
[Spain] |
| Offer Type: sell |
Category: Office Supplies and Equipment > Office Equipment - Used
|
|
|
| 9. |
Used copiers for sale
Looking for good used copiers?Let me introduce to you the world leading company in the field of used copy machines: GM Technology (branch of TL Cop ... |
|
|
GM Technology
[Spain] |
| Offer Type: sell |
Category: Office Supplies and Equipment > Office Equipment - Used
|
|
|
| 10. |
CJC1295
peptide name: CJC-1295
peptide sequence: Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Molecular Weight: 3367.8
Purity: 99.6% ... |
 |
|
GL Biochem(Shanghai) Ltd.
[China] |
| Offer Type: sell |
Category: Biotech > Biotech Supplies
|
|
|
