| 1. |
 CJC1295
peptide name: CJC-1295
peptide sequence: Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Molecular Weight: 3367.8
Purity: 99.6% ... |
 |
|
GL Biochem(Shanghai) Ltd.
[China] |
| Offer Type: sell |
Category: Biotech > Biotech Supplies
|
 |
| 2. |
PT141
Product Name Bremelanotide PT-141 Sequence Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Cas No. 32780-32-8 Molecular Formula C50H68N ... |
 |
|
GL Biochem(Shanghai) Ltd.
[China] |
| Offer Type: sell |
Category: Biotech > Biotech Supplies
|
|
|
| 3. |
Melanotan-II (MT-II)
Melanotan-II (MT-II)
Melocular structural fomula: C50H69N15O9
Sequence: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH2
CAS: 121062-08-6
Molecular ... |
 |
|
GL Biochem(Shanghai) Ltd.
[China] |
| Offer Type: sell |
Category: Biotech > Biotech Supplies
|
|
|
| 4. |
perforated metal
Blatt has more than ten years experiences in perforated metal screen manufacture and processing started since 1995. On this site, we introduce our ... |
 |
|
Blatt Perforated Metal Co.
[China] |
| Offer Type: sell |
Category: Manufacturing > Wire-Steel
|
|
|
| 5. |
Dali brand Yuda Politary
Yuda Pilatory is formulated with active ingredients of purely natural Chinese herbs under High technical bioengineering, it mainly used for hair loss ... |
 |
|
Kunming Dali industry&trade Co.,Ltd.
[China] |
| Offer Type: sell |
Category: Beauty and Health Care > Hair care products
|
|
|
| 6. |
Botanical product Zisu Capsule
This product extracts the ingredients of natural herbal.Zisu with modern advanced technology and is processed into capsule in GMP factory.
Applicab ... |
 |
|
Kunming Dali industry&trade Co.,Ltd.
[China] |
| Offer Type: sell |
Category: Pets and Pet Supplies > Health care products
|
|
|
| 7. |
Lidadaidaihua Capsule
With modern technology, Lida Daidaihua Capsule is made of the extracts from Daidaihua, a plant growing in Yunnan, the kingdom of green vegetation, whi ... |
 |
|
Kunming Dali industry&trade Co.,Ltd.
[China] |
| Offer Type: sell |
Category: Pets and Pet Supplies > Health care products
|
|
|
| 8. |
hair connector, straightener,curler rion
our hair tools includes:
hair clips, hair hook needle, micro ring, glue and adhesive for hair extension and toupees, pliers and glue gun for hair e ... |
 |
|
Furich Arts & Crafts Co., Ltd.
[China] |
| Offer Type: sell |
Category: Beauty and Health Care > Hair related products
|
|
|
| 9. |
hair clips, hair hook needle, micro ring
our hair tools includes:
hair clips, hair hook needle, micro ring, glue and adhesive for hair extension and toupees, pliers and glue gun for hair e ... |
 |
|
Furich Arts & Crafts Co., Ltd.
[China] |
| Offer Type: sell |
Category: Beauty and Health Care > Hair related products
|
|
|
| 10. |
lesson wigs, mannequin
lesson wigs are made from human hair and animal hair.
model head are made from hard PVC, soft PVC, foamy plastic and resin
... |
 |
|
Furich Arts & Crafts Co., Ltd.
[China] |
| Offer Type: sell |
Category: Beauty and Health Care > Hair related products
|
|
|
