Make AAT! your home page Add to Favorites
Global Business Trade Leads Portal - Find Trade Offers, Import and Export Trade Lead, B2B Trade Leads, Buy Sell Purchase, Import Export, Create Showroom, Directory Service, Auctions, Directories, Trade Forums
Home Auctions Trade Offers Biz Directory Trade Info Showrooms Business Tools Forums
Home > Offers > biotech supplies exporters
Showing 1 - 10 offers 43485 results on 4349 pages
1. China Hangers And Clips
JMTACC is a manufacturer & exporter of hanger, hook, plastic size tag, clip, collar support
"JMTACC" registered trademark garments accessories are ...
JMTACC Garments Accessories Co., Ltd. [China]
Offer Type: sell Category: Consumer Goods and Appliances > Household Items and Cleaning Supplies
2. China sell Life buoy
Code: SF5555
Item Name: Life buoy


Features:
a) Emits smoke to catch attention
b) Used as an individual life saving device by seamen ...

sunfine marine [China]
Offer Type: sell Category: Marine > Marine Industrial Supplies
3. China sell Immersion Suit
Code: SFB-2
Item Name: INSULATED IMMERSION AND THERMAL PROTECTIVE SUIT


Product Inspection Standard: Requirements of 1996 Amendments to SOLA ...

sunfine marine [China]
Offer Type: sell Category: Marine > Marine Industrial Supplies
4. China Household Utensil
JMTACC is a manufacturer & exporter of bottle opener, key rings, cup & mug, photo frame, move picture, table gifts, cap, umbrella, mobile tape, lighte ...
JMTACC Garments Accessories Co., Ltd. [China]
Offer Type: sell Category: Consumer Goods and Appliances > Household Items and Cleaning Supplies
5. Spain Konica used copiers for sale
1312----------------------35 units
7013----------------------10 units
7015----------------------03 units
7020----------------------58 units
GM Technology [Spain]
Offer Type: sell Category: Office Supplies and Equipment > Office Equipment - Used
6. Spain Minolta used copiers for sale
CF 2001------------------6 units
CF 2002----------------36 units
CF 9001----------------34 units
CF 910-------------------2 units
Di 151-- ...
GM Technology [Spain]
Offer Type: sell Category: Office Supplies and Equipment > Office Equipment - Used
7. Spain Ricoh used copiers for sale
RICOH Aficio 1013-------------------67 units
RICOH Aficio 1013F------------------20 units
RICOH Aficio 1113--------------------37 units
RICOH ...
GM Technology [Spain]
Offer Type: sell Category: Office Supplies and Equipment > Office Equipment - Used
8. Spain Used copiers for sale
Looking for good used copiers?

Let me introduce to you the world leading company in the field of used copy machines: GM Technology (branch of TL Cop ...

GM Technology [Spain]
Offer Type: sell Category: Office Supplies and Equipment > Office Equipment - Used
9. Spain Used copiers for sale
Looking for good used copiers?

Let me introduce to you the world leading company in the field of used copy machines: GM Technology (branch of TL Cop ...

GM Technology [Spain]
Offer Type: sell Category: Office Supplies and Equipment > Office Equipment - Used
10. China CJC1295
peptide name: CJC-1295
peptide sequence: Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Molecular Weight: 3367.8
Purity: 99.6% ...
GL Biochem(Shanghai) Ltd. [China]
Offer Type: sell Category: Biotech > Biotech Supplies
Related Results
Related Auctions
Related Showrooms
Related Forums

Sponsored Offers
1991 HITACHI EX200-2 for sale
1991 hitachi ex200-2 for export at usd75,000. if y

1993 CATERPILLAR CP-563
1993 CATERPILLAR CP-563 at usd60,000 for export to

we sell all kinds of agriculture products
we are exporters of all kinds of agriculture produ

CATERPILLAR 966D for sell
CATERPILLAR 966D for sell at usd55,000 fob locatio

1998 Hitachi EX200-5 for sales
we have 1998 hitachi EX200-5 for sales at usd48,00

1983 Kawasaki 85Z for export
we have 1983 kawasaki 85z for export to the middle

we import and export live animals
we are importers and exporters of live animals.

1993 CATERPILLAR 307SSR for sell
1993 CATERPILLAR 307SSR, 1993 Caterpillar 307SSR 4

 1 2  3  4  5  6  7  8  9  10  11  12 
Home - FAQ - Site Map - Success Stories - About Us - Partners - Contact Us - Link to Us - Resources
Job Opportunities - AAT Publications - Advertise with Us - Why Advertise Here? - Send your Comments
Sell & Buy Offers - Products Auctions - Products & Showrooms - Archive - Hot Keywords - Trade Sites - Exhibitions
© Copyright 2001-2007 AllActionTrade.com. All Rights Reserved. Privacy Policy - Terms of Service